ELISA Recombinant Rat Presqualene diphosphate phosphatase(Ppapdc2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q66H88 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGGGGSGRFEFQSLLSCRSGADPACARLRASD SPVHRRGSFPLAAACPAQVAPAPPPEDAGMNLNPSFLGIALRSLLAIDLWLSKKLGVCAG ESSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLMNLLFALLLDLLLVAV IKGLVRRRRPAHNQMDMFFTLSVDKYSFPSGHATRAALVSRFILNHLVLAIPLRVLVVLW AFVLGLSRVmLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPLNVPVLFVLWNQQ Protein Names:Recommended name: Presqualene diphosphate phosphatase EC= 3.1.3.- Alternative name(s): Phosphatidic acid phosphatase type 2 domain-containing protein 2 Gene Names:Name:Ppapdc2 Expression Region:1-293 Sequence Info:fµLl length protein