ELISA Recombinant Rat Taste receptor type 2 member 113(Tas2r113)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q67ES1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVAVLQSTFAIIFSMEFIVGTLGNGFIILMTCIDWVRRRKISLVDQILTALAITRITLIL LVFIDWWVSVLFPALHETGKILRMYFISWTVINHCNLWLTASLSIIYFLKIASFSSIIFL YLKFRVKNVVFVTLLVSLFFLFINTAIVNVYFDVCFDGVQRNVSQVSRLYNHEQICKFLS FTNPMFAFIPFVTSMATFFLLIFSLWRHLKNMKHNAEGCRDVSTIVHIRALQTIIVSVVL YSTFFLSFFVKVWSSGSPERYLIFLFVWALGNAVLPAHTFVLIWGNCRLRWASLSLmLWL RYRFKNIDV Protein Names:Recommended name: Taste receptor type 2 member 113 Short name= T2R113 Alternative name(s): Taste receptor type 2 member 30 Short name= T2R30 Gene Names:Name:Tas2r113 Synonyms:Tas2r30 Expression Region:1-309 Sequence Info:fµLl length protein