ELISA Recombinant Propionibacterium acnes ATP synthase subunit b(atpF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Propionibacterium acnes (strain KPA171202 / DSM 16379) Uniprot NO.:Q6A8C3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNILEMDLGPLAPEHPIEIIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAE RAQAEAKAALEKYQAQLASARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQ IQAERDQAVREVRAEIGGLATTLASRIVGESLQDDQRVQATVDRFLSSLADEPSASNSRT VNRA Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b Gene Names:Name:atpF Ordered Locus Names:PPA1243 Expression Region:1-184 Sequence Info:fµLl length protein