ELISA Recombinant Rat Apolipoprotein L domain-containing protein 1(Apold1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6B959 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKWTAWEPQGADALRRFQGLLLDRRGRLHCQVLRLREVARRLERLRRRSLAANVAGSSL SAAGALAAIVGLSLSPVTLGASLVASAVGLGVATAGGAVTITSDLSLIFCNSREVRRVQE IAATCQDQMRELLSCLEFFCQWQGRGDRQLLQSGRDASMALYNSVYFIVFFGSRGFLIPR RAEGATKVSQAVLKAKIQKLSESLESCTGALDELSEQLESRVQLCTKAGRGHNLRNSPDL DAALFF Protein Names:Recommended name: Apolipoprotein L domain-containing protein 1 Alternative name(s): VascµLar early response gene protein Gene Names:Name:Apold1 Synonyms:Verge Expression Region:1-246 Sequence Info:fµLl length protein