Skip to Content

ELISA Recombinant Yarrowia lipolytica Probable endonuclease LCL3(LCL3)

https://www.anagnostics.com/web/image/product.template/161737/image_1920?unique=7c948e0
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6C427 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPEDSNKASNTARVVFYTSILTGGILSSFYVYSRYFRRFTCTAEVPKKIYRGRTLFGRVT SVGDGDNFHFYHTPGGRLAGWGWLRPYPETNKRGLGKETLHIRLYGVDAPERPHFGRQGQ PYGDEALEWLRSYILGRNVRVKLFSPDQYGRIVGGAKVWKLTGRKDVSTEmLKNGWGVKY EGKMGAEFNGKGKLFQKLEDHARKKKIGMFQQKGKIVTPGQYKKDE Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.- Gene Names:Name:LCL3 Ordered Locus Names:YALI0E30305g Expression Region:1-226 Sequence Info:fµLl length protein

1,574.00 € 1574.0 EUR 1,574.00 €

1,574.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.