ELISA Recombinant Yarrowia lipolytica Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6CFW6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AGTAPVPLTWERFLLLRTRRRQINFVASIFTGVATSVLAWGFISEAELDLEQQDVFFGLD AFTAAGLGVVAAGFMGSLLGPTIGQLIFKATNSKQWPAFLMKETDFLSHIQKNRVNPRYQ SVSNPVPDYYGEKIGSLKDYRRWLRDCAKYNRAREV Protein Names:Recommended name: Presequence translocated-associated motor subunit PAM17, mitochondrial Gene Names:Name:PAM17 Ordered Locus Names:YALI0B02992g Expression Region:30-185 Sequence Info:fµLl length protein