ELISA Recombinant Pongo abelii ADP-ribosylation factor-like protein 6-interacting protein 1(ARL6IP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R454 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEGDNRSSNLLAAETASLEEQLQGWGEVmLMADKVLRWERAWFPPAIMGVVSLVFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII SKYIGMAKREINKLLKQKEKKNE Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 1 Short name= ARL-6-interacting protein 1 Short name= Aip-1 Alternative name(s): Protein TBX2 Gene Names:Name:ARL6IP1 Synonyms:ARL6IP Expression Region:1-203 Sequence Info:fµLl length protein