ELISA Recombinant Pongo abelii Probable palmitoyltransferase ZDHHC21(ZDHHC21)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RB84
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFC LVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIM RLAAFMGITmLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTR WKILWFIPFRQRQPLRVPYHFANHV
Protein Names:Recommended name: Probable palmitoyltransferase ZDHHC21 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 21 Short name= DHHC-21
Gene Names:Name:ZDHHC21
Expression Region:1-265
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.