ELISA Recombinant Pongo abelii Probable palmitoyltransferase ZDHHC21(ZDHHC21)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RB84 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFC LVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIM RLAAFMGITmLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTR WKILWFIPFRQRQPLRVPYHFANHV Protein Names:Recommended name: Probable palmitoyltransferase ZDHHC21 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 21 Short name= DHHC-21 Gene Names:Name:ZDHHC21 Expression Region:1-265 Sequence Info:fµLl length protein