ELISA Recombinant Pongo abelii Cytochrome b5 type B(CYB5B)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RDJ5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KGQEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREmLKQYYIGDIHPSDLKPENGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTPESKSS
Protein Names:Recommended name: Cytochrome b5 type B Alternative name(s): Cytochrome b5 outer mitochondrial membrane isoform
Gene Names:Name:CYB5B Synonyms:CYB5M
Expression Region:12-146
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.