ELISA Recombinant Rat Methyltransferase-like protein 23(Mettl23)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5RJL2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGARLFRFRDEPGPGADPTVLEVRVPQVLHVQYGMYVWPCAVVLAQYLWFHRRVLPGKA VLEIGAGVSLPGILAAKCGAKVTLSDSPELPHCLDICWQSCQMNNLPQVQIVGLTWGHIS KDTLSLPPQDIILGSDVFFEPEDFESILATVYFLMQKNPKVQFWSTYQVRSADWSLEGLL YKWDMRCVHIPLESFDADKEDIAESTLPGRHTIEmLIISFAKDSS Protein Names:Recommended name: Methyltransferase-like protein 23 EC= 2.1.1.- Gene Names:Name:Mettl23 Expression Region:1-225 Sequence Info:fµLl length protein