ELISA Recombinant Rat Neuropeptide Y receptor type 4(Ppyr1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q63447 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNTSHLMASLSPAFLQGKNGTNPLDSLYNLSDGCQDSADLLAFIITTYSVETVLGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKmLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVVIWFISCFLSLPFLANSIL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCVPLAFILVCYMRIYQR LQRQRRAFHTHTCSSRVGQMKRINGmLMAMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLFAMASTCVNPFIYGFLNINFKKDIKALVLTCRCRPPQGEPEPLPLSTVHTD LSKGSMRMGSKSNVM Protein Names:Recommended name: Neuropeptide Y receptor type 4 Short name= NPY4-R Alternative name(s): Pancreatic polypeptide receptor 1 Short name= PP1 Gene Names:Name:Ppyr1 Synonyms:Npy4r Expression Region:1-375 Sequence Info:fµLl length protein