ELISA Recombinant Xenopus laevis S-adenosylmethionine mitochondrial carrier protein(slc25a26)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q641C8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERRELCASLLAGGAAGMSVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGS FPNAAAFFVTYESAKRFLGSDSSYLSPIIHMAAAFLGELVACLIRVPSEVIKQRAQVSPS STTYQmLSVTLREEGIKGLYRGYKSTVLREIPFSLVQFPLWEFLKNLWSWKQGRAVDCWQ SAVCGAFAGGFAAAVTTPLDVAKTRImLAKAGSGVANGNVLFALHEIWRTQGIMGLFAGV IPRMTMISLGGFIFLGAYDKVRSSLL
Protein Names:Recommended name: S-adenosylmethionine mitochondrial carrier protein Alternative name(s): Mitochondrial S-adenosylmethionine transporter Solute carrier family 25 member 26
Gene Names:Name:slc25a26 Synonyms:samc
Expression Region:1-266
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.