ELISA Recombinant Rat Trans-2,3-enoyl-CoA reductase(Tecr)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q64232 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKHYEVEIRDAKTREKLCFLDKVEPQATISEIKTLFTKTHPQWYPARQSLRLDPKGKSLK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACMCHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN HPLYTPPTYGVQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF LLVSCPNYTYEVGSWIGFAIMTQCVPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL Protein Names:Recommended name: Trans-2,3-enoyl-CoA reductase Short name= TER EC= 1.3.1.38 Alternative name(s): Synaptic glycoprotein SC2 Gene Names:Name:Tecr Synonyms:Gpsn2 Expression Region:1-308 Sequence Info:fµLl length protein