Skip to Content

ELISA Recombinant Rat Taste receptor type 2 member 140(Tas2r140)

https://www.anagnostics.com/web/image/product.template/153075/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q67ES0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKVTVECALLITLIVEIIIGCLGNGFIAVVNIMDWTKRRRFSLVDQILTALAISRLAFVW SLLTVLVISELHSSLLITRKmLRIINNFWTVTNHFSIWLATCLSIFYFLKIANFSNSIFL SLRWRVKTVVSLTLLVSLLLLLVNVIIINTCIVISVEGYKVNMSYSSHFNNNPQISRIPL FTNTMFTFIPFTVTLTIFLLLIFSLWRHLKKMQHRAKGPRDPSTTAHIKALQMVVTFLFL YTIFFLALVMQAWNNEIQSKTVFNLVFESIALAFPSGHSCVLILGNSKLRQAFLTIIWWL RSSFNAAELSSP Protein Names:Recommended name: Taste receptor type 2 member 140 Short name= T2R140 Alternative name(s): Taste receptor type 2 member 31 Short name= T2R31 Gene Names:Name:Tas2r140 Synonyms:Tas2r31 Expression Region:1-312 Sequence Info:fµLl length protein

1,664.00 € 1664.0 EUR 1,664.00 €

1,664.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.