ELISA Recombinant Rat ADP-ribosylation factor-like protein 6-interacting protein 6(Arl6ip6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q68FV2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFVESWRSVGPRRRRQVTPGPVTRSVYSDYTQGNSWSEDGDEGCDQVARDLRAEFSARA SSESKRAPLLPRIGDGSPVLPDKRNGIFPATAAKRTQARRWPIQALSILCSLLFAVLLAF LLAIAYLIVKELHTENSKNEDVVDTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSFEPG MFPPTPLSPARFKKLTGHSFHMGYSMAILNGVVAALTVAWCLM Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 6 Short name= ARL-6-interacting protein 6 Short name= Aip-6 Gene Names:Name:Arl6ip6 Expression Region:1-223 Sequence Info:fµLl length protein