ELISA Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041(RT0041)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington) Uniprot NO.:Q68XW4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVA MTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEI ATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNF NSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELLFKV Protein Names:Recommended name: Probable ABC transporter permease protein RT0041 Gene Names:Ordered Locus Names:RT0041 Expression Region:1-259 Sequence Info:fµLl length protein