Skip to Content

ELISA Recombinant Pongo pygmaeus Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

https://www.anagnostics.com/web/image/product.template/150188/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:Q69BK3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SHTDVRVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNVVTQFVS SMSASADVLALAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPIYEFTSDDMVIVG Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5 Cytochrome b-c1 complex subunit 5 Rieske iron-sµLfur protein Short name= RISP Ubiquinol-cytoc Gene Names:Name:UQCRFS1 Expression Region:79-274 Sequence Info:fµLl length protein

1,542.00 € 1542.0 EUR 1,542.00 €

1,542.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.