ELISA Recombinant Propionibacterium acnes Protein CrcB homolog 1(crcB1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Propionibacterium acnes (strain KPA171202 / DSM 16379) Uniprot NO.:Q6A9P0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAMRSGFLDRRPVLVGLVFLGGCLGTLIRSVIAHAWPSRADGVPWGTLAINLVGAFVLAT LLELLVHAGPDRGVRRAVRLCIGTGLLGGFTTYSALTVEAGQRVMSGQWLWGIAYLLTSV AAGALLAWVVIAAVRCVMGKRSS Protein Names:Recommended name: Protein CrcB homolog 1 Gene Names:Name:crcB1 Ordered Locus Names:PPA0770 Expression Region:1-143 Sequence Info:fµLl length protein