ELISA Recombinant Yarrowia lipolytica Assembly factor CBP4(CBP4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6C5S0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLENWPIVEMFRSRPGVPNWPKFGLFAVGVIGSAYLGYRYATPSEEDIVRRMNPELRER YmLERDARQEYFNEFVKEAIAQSKTNEPIWKVGPMASKPIDFNVAVREKMKEIEARNDQD RNERIKNELAAIAKKEEEEKNKKGWW Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA-processing protein 4 Gene Names:Name:CBP4 Ordered Locus Names:YALI0E15686g Expression Region:1-146 Sequence Info:fµLl length protein