ELISA Recombinant Pongo abelii PDZK1-interacting protein 1(PDZK1IP1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RA41 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAFGLLILGLLTAVPPASCRQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPE PAHMILTIGNKADGVLVGTDGRYSSVAASFRSSEHENAYENVPEEEGKVRSTPM Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein Gene Names:Name:PDZK1IP1 Expression Region:1-114 Sequence Info:fµLl length protein