ELISA Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit Tim21(TIMM21)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5REP2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LAKRLLLPHIVLNKACLKTEPSLRCRLQYQKKTVLPRCILGVTQKTIWTQGPSPGKAKED SSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSP SKIYGRALEKCRSHPEGRSSHRPRSDVIARICSP Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit Tim21 Alternative name(s): TIM21-like protein, mitochondrial Gene Names:Name:TIMM21 Synonyms:TIM21 Expression Region:19-172 Sequence Info:fµLl length protein