Skip to Content

ELISA Recombinant Rat Metalloreductase STEAP3(Steap3)

https://www.anagnostics.com/web/image/product.template/152571/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5RKL5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGEMDKPLISRRLVDSDGSLAEVPKEAPKVGILGSGDFARSLATRLVGSGFSVVVGSRN PKRTAGLFPSLAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLADQLAGKILVDVSNPTEK ERLQHRQSNAEYLASLFPACTVVKAFNVISAWALQAGPRDGNRQVLICGDQLEAKHTVSE MARAMGFTPLDMGSLASAREVEAIPLRLLPSWKVPTLLALGLFVCFYAYNFIRDVLQPYI RKDENKFYKMPLSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ HRKQIGLLSFFFAmLHALYSFCLPLRRSHRYDLVNLAVKQVLANKSRLWVEEEVWRMEIY LSLGVLALGmLSLLAVTSIPSIANSLNWKEFSFVQSTLGFVALmLSTMHTLTYGWTRAFE ENHYKFYLPPTFTLTLLLPCVIILAKGLFLLPCLSHRLTKIRRGWERDGAVKFmLPAGHT QGEKTSHV Protein Names:Recommended name: Metalloreductase STEAP3 EC= 1.16.1.- Alternative name(s): Six-transmembrane epithelial antigen of prostate 3 pHyde Gene Names:Name:Steap3 Expression Region:1-488 Sequence Info:fµLl length protein

1,850.00 € 1850.0 EUR 1,850.00 €

1,850.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.