ELISA Recombinant Yarrowia lipolytica Mitochondrial thiamine pyrophosphate carrier 1(TPC1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6C107 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNHLSSDSDISSTESmLCGGIAGMVSRFCIAPLDVVKIRLQLQKDGSRYYRGIFQTMQQ IVRDEGVTALWKGNIPAELLYVFYGATQFVTYHHVNQVINAYNETAEKWKISSGAQSFIA GATAGAGATIATYPFDLFRTLFAAQGAKNCNVKNYTSLFQTFKLIYKTEGPLGFFRGVSS SIISIAPYMGLFFASYGRVKDSLDAFSNKHHDLLVSYNLPTKGWQEATAGLCAGTASKAL VFPLDTIRKRLQTQGRMDVSYKELSGKPGVQRLLDSYNPFVMARRIIVAEGCRGLYKGFL VSLIKSAPTSAITMYTFEKSLSILRWWKAQGKSLEA Protein Names:Recommended name: Mitochondrial thiamine pyrophosphate carrier 1 Gene Names:Name:TPC1 Ordered Locus Names:YALI0F20262g Expression Region:1-336 Sequence Info:fµLl length protein