ELISA Recombinant Xenopus laevis Kidney mitochondrial carrier protein 1(slc25a30)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GQ22 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTALNWKPFIYGGLASITAECGTFPIDLTKTRLQVQGQPNDAKYKEIRYRGMMHAIVRIW REEGVKALYSGIAPAmLRQASYGTIKIGTYQSLKRLFVDCPEDETLVLNAFCGVLSGVVS SCIANPTDVLKIRMQAQGNVMQGGMIVNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVEL PVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRSIRDASNS SYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKLNL Protein Names:Recommended name: Kidney mitochondrial carrier protein 1 Alternative name(s): Solute carrier family 25 member 30 Gene Names:Name:slc25a30 Synonyms:kmcp1 Expression Region:1-291 Sequence Info:fµLl length protein