ELISA Recombinant Rabbitpox virus Late protein H7 homolog(RPXV094)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rabbitpox virus (strain Utrecht) (RPV) Uniprot NO.:Q6RZJ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEMDKRMKSLAMTAFFGELSTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPIFGDECKTHASSIAEQLACADIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC Protein Names:Recommended name: Late protein H7 homolog Gene Names:ORF Names:RPXV094 Expression Region:1-146 Sequence Info:fµLl length protein