ELISA Recombinant Rat Lipid phosphate phosphatase-related protein type 2(Lppr2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6W5G4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGGRPHLKRSFSIIPCFVFVESVLLGIVVLLAYRLEFTDTFPVHTQGFFCYDSAYAKPY PGPEAASRAPPALIYALVTAGPTLTILLGELARAFFPAPPSSSPVSGESTIVSGACCRFS PPLRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPG PDRFVTDQSACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPHSGRRLSP WEDLSQAPTMDSPLEKNPRPAGRIRHRHGSPHPSRRTVPAVAT Protein Names:Recommended name: Lipid phosphate phosphatase-related protein type 2 EC= 3.1.3.4 Alternative name(s): Plasticity-related gene 4 protein Short name= PRG-4 Gene Names:Name:Lppr2 Synonyms:Prg4 Expression Region:1-343 Sequence Info:fµLl length protein