ELISA Recombinant Rat ATP synthase lipid-binding protein, mitochondrial(Atp5g3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q71S46 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P3 ATPase protein 9 ATPase subunit c Gene Names:Name:Atp5g3 Expression Region:68-142 Sequence Info:fµLl length protein