Skip to Content

ELISA Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2(mnhE2)

https://www.anagnostics.com/web/image/product.template/158286/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain N315) Uniprot NO.:Q7A724 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWAITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR Protein Names:Recommended name: Putative antiporter subunit mnhE2 Alternative name(s): Mrp complex subunit E2 Putative NADH-ubiquinone oxidoreductase subunit mnhE2 Gene Names:Name:mnhE2 Synonyms:mrpE2 Ordered Locus Names:SA0582 Expression Region:1-160 Sequence Info:fµLl length protein

1,504.00 € 1504.0 EUR 1,504.00 €

1,504.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.