ELISA Recombinant Vibrio vulnificus Fumarate reductase subunit D(frdD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio vµLnificus (strain YJ016) Uniprot NO.:Q7MGX4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKPNYNVDRAPKRSDEPVWWSLFGAGGTWFAMITPVTVLVLGILVPMGVINAEALSYDRV VSFATSIIGALFIIATLALPMWHAMHRVHHGMHDLKFHTGVVGKIACYAIAGLISALAVV FIFmL Protein Names:Recommended name: Fumarate reductase subunit D Gene Names:Name:frdD Ordered Locus Names:VV3100 Expression Region:1-125 Sequence Info:fµLl length protein