ELISA Recombinant Rat Mas-related G-protein coupled receptor member E(Mrgpre)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q7TN40 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLRVHTHSPSTQGDMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLDV ACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLImLRFFCYIVGLSLLVAISTEQCLAT LFPSGYLCRRPRYLTTCVCAFIWVLCLLLDLLLSGACTQFFGAPSYHLCGmLWLVVAVLL AALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLVILLFLFCGLPFGIFWLSKNLSWH TPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFQEPLRLVLQRALGDEAELGAVREAS QGGLVDMTV Protein Names:Recommended name: Mas-related G-protein coupled receptor member E Gene Names:Name:Mrgpre Synonyms:Mrge Expression Region:1-309 Sequence Info:fµLl length protein