ELISA Recombinant Xenopus tropicalis S-adenosylmethionine mitochondrial carrier protein(slc25a26)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6GLA2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERREFCASLLAGGTAGMCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGS FPNAAAFFVTYESAKQLLRSDSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQVSPS STTYQmLSATLRQEGIKGLYRGYKSTVLREIPFSLVQFPLWESLKDLWSWKQGRAVDSWQ SAVCGAFAGGFAAALTTPLDVAKTRImLAKAGSGVASGNVLFALHEIWRTQGIMGLFAGV IPRMTAISLGGFIFLGAYDKVRTLmLREQ Protein Names:Recommended name: S-adenosylmethionine mitochondrial carrier protein Alternative name(s): Mitochondrial S-adenosylmethionine transporter Solute carrier family 25 member 26 Gene Names:Name:slc25a26 Synonyms:samc Expression Region:1-269 Sequence Info:fµLl length protein