Skip to Content

ELISA Recombinant Xenopus laevis Atlastin-2(atl2)

https://www.anagnostics.com/web/image/product.template/161124/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GN29 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEGGSLRNRTRFGSRSNEAMNHVDYPDENFVEEIQLNSDTEVMEKPRPIQIVLAHEDDH NFELDETALESILMQDHIRDLNVVVLSVAGAFRKGKSFLLDFmLRFMYSQSSSWIGGNYE PLTGFTWRGGCERETTGIQIWSEVFVVEKPDGSKVAVILMDTQGAFDSQSTIKDCATVFA LSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYKKPFQTLMFLIRDWSYPYEH SYGLEGGNKFLEKRLQVKQNQHEELQNVRKHIHSCFTNIGCFLLPHPGLKVATNPYFDGR LVEIDDEFKKELRELVPLLLAPENLVEKEISGSKVTCRDLLEYFKAYIKIYQGEELPHPK SmLQATAEANNMAAVAGAKDTYSRSMEQVCGGDKPYIAPSDLERKHLDLKETCIKQFRSV KKMGGEEFCRRYQEQLEAEIEETYANFLKHNDGKNIFYAARTPATLFAVMFAMYIISGLT GFIGMNSIATICNLIMGLTLLSFCTWAYVKYSGEFRELGTLIDQIAEIIWEQLLKPLSDN LMEDNIRQTVRNSIKAGLTDQVSGRLKTN Protein Names:Recommended name: Atlastin-2 EC= 3.6.5.- Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 2 Short name= ARL-6-interacting protein 2 Short name= Aip-2 Gene Names:Name:atl2 Synonyms:arl6ip2 Expression Region:1-569 Sequence Info:fµLl length protein

1,936.00 € 1936.0 EUR 1,936.00 €

1,936.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.