ELISA Recombinant Xenopus tropicalis Solute carrier family 25 member 40(slc25a40)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6P316 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQKNTEPVQEAINITPSQQMIASSMGALLTSFFVTPLDVVKIRLQAQSKPFIKGKCFVYC NGLMDHLCLCTNGNGKAWYRAPGHFRGTTDAFVQIIRNEGIKSLWSGLPPTLVMAVPATV IYFTCYDQLRDILIRSMPERAEIASLVAGATARLWSATLISPLELIRTKMQYRPLSYKEL RQCIQSSVAKDGWLALWKGWGPTVLRDVPFSALYWHNYELVKQSLCQRYNTLQPTFAISF TAGAVSGSIAAIVTLPFDVVKTRRQVEVGELEMFTYSQKRSSSTWKLMRAIVIENGFGGL FAGLIPRLIKVAPACAIMISTYEFGKSFFRKLNNERQLKSL Protein Names:Recommended name: Solute carrier family 25 member 40 Gene Names:Name:slc25a40 Expression Region:1-341 Sequence Info:fµLl length protein