ELISA Recombinant Rat Monocyte to macrophage differentiation protein(Mmd)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q719N3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL Protein Names:Recommended name: Monocyte to macrophage differentiation protein Alternative name(s): Macrophage/microglia activation-associated factor Short name= MAF Progestin and adipoQ receptor family member XI Gene Names:Name:Mmd Synonyms:Maf, Paqr11 Expression Region:1-238 Sequence Info:fµLl length protein