Skip to Content

ELISA Recombinant Prochlorococcus marinus Apolipoprotein N-acyltransferase(lnt)

https://www.anagnostics.com/web/image/product.template/150408/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) Uniprot NO.:Q7VAT8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLALSRSKYFAFLTGTVGGLLAGVGLSQGGVVFIWISTACLWASMAFPSAVFLWGLFAIL LSYRWLLYLHPLTWIGVPIAFSLPIAILIWFSCGLLGGLLVALWSLIGQIPFFQRRLNSS TKDQLLYVIALSLIWGLVEVGLAKSPFFWFGLGDSLLPYDRWLAGLARWFGSGGLAALQL ILGWWVWKIIFAFKKGSPWLGLFALGVCSLLLAHCIGWILLADNEFTSSKRIALWQTNIP TRQKFTLRELKRLPISLQDALEEADNLGADWMVAPEGTLSAGQNLLAPSPLPLLSGGFRR VKNKQMSSLLVFNEGSTSYSSAIDKHRLVPLGEWLPSLPGVNWNGLSFVGGVDPGDASRF FDWDGGPLAVAICYELSDGNNLAKAIFDGAEWILAIANLDPYPISLQRQFLALAQLRSIE SARNLISVANTGPTSMILSSGKIKSIIEPFNEGVGVIDINVSQKISGYVRWGEIPLISSL LIVLCFIARLKGKA Protein Names:Recommended name: Apolipoprotein N-acyltransferase Short name= ALP N-acyltransferase EC= 2.3.1.- Gene Names:Name:lnt Ordered Locus Names:Pro_1366 Expression Region:1-494 Sequence Info:fµLl length protein

1,856.00 € 1856.0 EUR 1,856.00 €

1,856.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.