Skip to Content

ELISA Recombinant Xenopus laevis Zinc transporter 6-B(slc30a6-b)

https://www.anagnostics.com/web/image/product.template/161441/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GPY1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGTIYLFRKTQRSLLGKLTQEFRLVTADRRSWKILLFGAINVVCTGFLLTWCSSTNSMAL TAYTYLTIFDLFSLITSLISYWVMMKKPSPTYSFGFERLEVLAVFASTVLAQLGALFILK ESAERFLEQPEIHTGRLLVGTFVALFFNLFTmLSIRNKPFAYVSEAASTSWLQEHVADLS RSLCGVIPGLSSIFLPRMNPFVLIDIAGALALCITYmLIEINNYFAVDTASAIAIAVMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLLREVSTLDGVLEVRNEHFWTLGFGTMAGSVH VRIRRDANEQMVLAHVTNRLSTLVSTPTVQIFKDDWARPVLASGTMPPNmLNIPEHHVIQ MPSLKSTVDELNPMTSTPSKPSGPPPEFAFNTPGKNMNPVILSNNQTRPFGVGYGTTPYT TTFNQGLGVPGVGNTQGLRTGLTNVANRYGTYTPGQFTQFRQ Protein Names:Recommended name: Zinc transporter 6-B Short name= ZnT-6-B Alternative name(s): Solute carrier family 30 member 6-B Gene Names:Name:slc30a6-b Synonyms:znt6-b Expression Region:1-462 Sequence Info:fµLl length protein

1,823.00 € 1823.0 EUR 1,823.00 €

1,823.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.