ELISA Recombinant Xenopus laevis E3 ubiquitin-protein ligase RNF182(rnf182)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6INB3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSQLSEDNSESPNLNSDELECKICYNRYNLRQRKPKVLGCCHRVCAKCLYKLVDCGESP QCVIVCPFCRFETRMPEDEVSSLPDDNNILLNLACGGRGKCVGDNPTELLLTPKRLSTIV TPSHTSTNCLVITIMEVQRESSPALNTTPMVEFYRPSNYDPVSIPQNWTVWNCTSLICKT SVRVFVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMIYGFCQCMCHEFL DCMSTP Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF182 EC= 6.3.2.- Alternative name(s): RING finger protein 182 Gene Names:Name:rnf182 Expression Region:1-246 Sequence Info:fµLl length protein