ELISA Recombinant Rat Solute carrier family 25 member 47(Slc24a47)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6J329 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDFVAGAIGGVCGVAVGYPLDTVKVKIQTEAKYTSIWHCVRDTYRQERLWGFYRGLSLPV CTVSLVSSVSFGTYHHCLAHICRFRYGSTDVKPTKADITLSGCASGLVRVFLTSPTEVAK VRLQTQAQSQTQQRRPSASWTSVAPALCPAPTACLEPRPKYSGPLHCLVTVAREEGLRGL YKGSSALLLREGHSFATYFLSYAVLSEWLTPAGQSQPDVLGVLVAGGCAGVLAWAVATPM DVIKSRLQADGQGQQRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEA VLRLTQGLLT Protein Names:Recommended name: Solute carrier family 25 member 47 Alternative name(s): HepatocellµLar carcinoma down-regµLated mitochondrial carrier homolog Gene Names:Name:Slc24a47 Synonyms:Hdmcp Expression Region:1-310 Sequence Info:fµLl length protein