ELISA Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD(icaD)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain MSSA476)
Uniprot NO.:Q6G607
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
Protein Names:Recommended name: Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD Short name= PGA synthesis protein IcaD Short name= Poly-beta-1,6-GlcNAc synthesis protein IcaD Alternative name(s): Biofilm polysaccharide intercellµLar ad
Gene Names:Name:icaD Ordered Locus Names:SAS2553
Expression Region:1-101
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.