ELISA Recombinant Xenopus laevis PQ-loop repeat-containing protein 1(pqlc1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6NRS2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEREGLEWIVAFLRmLVSWGASCAMIFGGVVPYIPQYRDIRRTQNAEGFSIYVCLmLLIA NILRILFWFGHHFESPLLWQSIIMIVTmLLmLKLCTEVRVANELNPKRRSFTDFDTAFFW HWTRFIDFIQCVLAFTGVTGYITYLLLDSPLFVEILGFLAVFTEALLGVPQLYRNHQNYS TEGMSIKMVLMWTSGDTFKSAYFVLNQAPFQFSICGLLQVFVDIAILLQVYLYSAYPQKP VSHATSAKAL Protein Names:Recommended name: PQ-loop repeat-containing protein 1 Gene Names:Name:pqlc1 Expression Region:1-250 Sequence Info:fµLl length protein