ELISA Recombinant Rat Estradiol 17-beta-dehydrogenase 12(Hsd17b12)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6P7R8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERALPAAGFLYWVGASTIAYLTLRASYSLFRAFQVWCVGNQAFVGPRLGEWAVVTGGTD GIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVETRTIAVDFSLDDIYDKIKT GLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSICKVTRLVLPGMVERS KGVILNISSASGmLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLA KIRKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIHAIMGSINSILPRWIYFKTIMGFNKS LRNRYLKKTKKN Protein Names:Recommended name: Estradiol 17-beta-dehydrogenase 12 EC= 1.1.1.62 Alternative name(s): 17-beta-hydroxysteroid dehydrogenase 12 Short name= 17-beta-HSD 12 3-ketoacyl-CoA reductase Short name= KAR EC= 1.3.1.- Gene Names:Name:Hsd17b12 Expression Region:1-312 Sequence Info:fµLl length protein