ELISA Recombinant Xenopus laevis Secretory carrier-associated membrane protein 5B(scamp5-b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GM42 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDKPNNFPPLPRFIPLKPCFYQDFDTDIPDVHRTTAKRLYYLWmLNSITLGVNLIGCLA WLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFNFMAFFFTFTGQLVISI IQAVGIPGWGVCGWIASISFFGTNVGSAVVmLIPTIMFTAVAVLSFVALTKVHRFYRGAG GSMSKAQEEWTTGAWKNPHVQQAAQNAAFGAAQGAMTQNEPQYSATPNYGYSNQM Protein Names:Recommended name: Secretory carrier-associated membrane protein 5B Short name= Secretory carrier membrane protein 5 B Gene Names:Name:scamp5-b Expression Region:1-235 Sequence Info:fµLl length protein