ELISA Recombinant Xenopus laevis 3-hydroxyacyl-CoA dehydratase(ptplad2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GNB5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKTYLSIYYLIQFCGHSWIFTNMTTRFLFFGQDAFADTFYSIGLVMQGCQLLSILELAHI LLGVEQNGFLPMFLQVAERFIILFVVITSQEEVQSKYIVCALFFIWNLWDVIRYPYDmLA AVDTDYSALTWLRHTWWIVAYPLSVLAEAYTIYESLPYFESLGTYSFKMALPVSLSFHFP YILTLYLVLQPVGmLYICSCLWSERKQYFQRKLKLKKN Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase Short name= HACD EC= 4.2.1.- Alternative name(s): Protein tyrosine phosphatase-like protein ptplad2 Protein-tyrosine phosphatase-like A domain-containing protein 2 Gene Names:Name:ptplad2 Synonyms:hacd Expression Region:1-218 Sequence Info:fµLl length protein