Skip to Content

ELISA Recombinant Rat 2-oxoglutarate receptor 1(Oxgr1)

https://www.anagnostics.com/web/image/product.template/151872/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6Y1R5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIETLDSPANDSDFLDYITALENCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYVF KMRPWKSSTIImLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS ILFLTCFSLFRYIVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR SACLDLTSSDDLTTIKWYNLILTATTFCLPLLIVTLCYTTIISTLTHGPRTHSCFKQKAR RLTILLLLVFYVCFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL LYVVVSNNFQQAFCSAVRCKAIGDLEQAKKDSCSNNP Protein Names:Recommended name: 2-oxoglutarate receptor 1 Alternative name(s): Alpha-ketoglutarate receptor 1 G-protein coupled receptor 80 P2Y purinoceptor 15 Short name= P2Y15 Gene Names:Name:Oxgr1 Synonyms:Gpr80, P2y15 Expression Region:1-337 Sequence Info:fµLl length protein

1,691.00 € 1691.0 EUR 1,691.00 €

1,691.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.