ELISA Recombinant Thermus thermophilus UPF0365 protein TT_C0686(TT_C0686)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) Uniprot NO.:Q72JT2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGLGIVFLAAVVLLFVFLFFSFIPVGLWISAWAAGVRVPLLTLVAMRLRRVPPAKIIYP LIKATKAGLDVRLDRLEAHYLAGGNVDRVVDALIAADKAGIKLTFDRAAAIDLAGRDVLE AVRVSVNPKVIQTPMVAAVAKDGIQLLATARVTVRANIDRLVGGAGEETIIARVGEGIVT TIGSANSHKEVLENPDRISKTVLEKGLDAGTAFEILSVDIADVDVGKNIGAQLQIDQAEA DKKIAQAKAEERRAMAVAAEQENRALVEAMRAKLVEAQAQVPLALAEALRKGHLGVMDYY RLKNIEADTDMRESISRAAKPEGEE Protein Names:Recommended name: UPF0365 protein TT_C0686 Gene Names:Ordered Locus Names:TT_C0686 Expression Region:1-325 Sequence Info:fµLl length protein