ELISA Recombinant Rhodopirellula baltica UPF0314 protein RB9128(RB9128)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:RhodopirellµLa baltica (strain SH1) Uniprot NO.:Q7UM18 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNASSSETLEVVDDRFQKDRSWTVAWIAGLIVVGMVLVLAGMGRRFWCECGSWVPWSWDI WTAHNSQHLIDPYFFSHVLHGVLFYWALRWVPRLNRTQCLLIALGLEASWEILENSPLII ERYREATMAVGYTGDSIANSVTDVAACmLGYWFSSRFPWRWSVALFVVSEILmLIMIRDN LLLNVLmLVSPIPAIQEWQSG Protein Names:Recommended name: UPF0314 protein RB9128 Gene Names:Ordered Locus Names:RB9128 Expression Region:1-201 Sequence Info:fµLl length protein