Skip to Content

ELISA Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase(icaA)

https://www.anagnostics.com/web/image/product.template/158129/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain MSSA476) Uniprot NO.:Q6G608 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESD TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWmLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR Protein Names:Recommended name: Poly-beta-1,6-N-acetyl-D-glucosamine synthase Short name= PNAG synthase Short name= Poly-beta-1,6-GlcNAc synthase EC= 2.4.1.- Alternative name(s): Biofilm polysaccharide intercellµLar adhesin synthesis protei Gene Names:Name:icaA Ordered Locus Names:SAS2552 Expression Region:1-412 Sequence Info:fµLl length protein

1,770.00 € 1770.0 EUR 1,770.00 €

1,770.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.