ELISA Recombinant Xenopus laevis Mitoferrin-2A(slc25a28-a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GLJ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELEAVLKERTAAAGDPGRVLGAWVRSGWSAAGPSVLESEGGSGGPLAFESTSSRILELA SKDNEPEYEALPDGSNVTTHmLAGAVAGVMEHCLMYPVDCVKTRMQSLQPDPAARYRNVM DALSKIVRTEGFWRPLRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNSHIANGT DYSCPA Protein Names:Recommended name: Mitoferrin-2A Alternative name(s): Mitochondrial iron transporter 2-A Solute carrier family 25 member 28-A Gene Names:Name:slc25a28-a Synonyms:mfrn2-a Expression Region:1-186 Sequence Info:fµLl length protein