Skip to Content

ELISA Recombinant Xenopus tropicalis Zinc transporter 7(slc30a7)

https://www.anagnostics.com/web/image/product.template/161637/image_1920?unique=7c948e0
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6P3N9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLPLSIKDDEYKPPKFNLVRKVSGWIRSIFSDTTSRNLFCFLCLNLSFAFVELFYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWKTNEAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGIERALDTPEVHHERLLPVSILGFLVNLIGIFVFQHGGGHGHSHESGHGHSHSLF NGSLSHGHSHSHGGSHGHSHGGGHGHSHSHGEGHGHSHDQSHKHGHGYGSSCHDEPPEEH TGSSKQILEGVFLHIVADALGSVGVIISTILMQRYGLMIADPICSmLIALLIFVSVIPLL KQSIGILMQRTPPSLDHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEA DARWILSQTHNIFTQAGVRQLYVQIDMAAM Protein Names:Recommended name: Zinc transporter 7 Short name= ZnT-7 Alternative name(s): Solute carrier family 30 member 7 Gene Names:Name:slc30a7 Synonyms:znt7 ORF Names:TEgg072f03.1 Expression Region:1-390 Sequence Info:fµLl length protein

1,747.00 € 1747.0 EUR 1,747.00 €

1,747.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.