ELISA Recombinant Rat Gamma-secretase subunit PEN-2(Psenen)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6QI68 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP Protein Names:Recommended name: Gamma-secretase subunit PEN-2 Alternative name(s): Liver regeneration-related protein LRRGT00140 Presenilin enhancer protein 2 Gene Names:Name:Psenen Expression Region:1-101 Sequence Info:fµLl length protein